This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
NPF / Neuropeptide F Antibody (Preservative Free) LS-C343389
catalog :
LS-C343389
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
fruit fly
product information
AntibodyID :
354228
AntibodyName :
LS-C343389
TargetSpecies :
Fruit fly
Host Species :
Rabbit
Product Name :
NPF / Neuropeptide F Antibody (Preservative Free) LS-C343389
Specificity :
The rabbit anti-Drosophila Neuropeptide F antibody shows strong binding to the synthetic immunogen. Its binding activity to native protein or cross reactivity with the protein derived from other species was not tested.
ClonalityDesc :
Polyclonal
AntibodyModification :
Preservative Free Unconjugated
PresentationDesc :
Lyophilized from PBS, No preservatives added
ImmunogenDesc :
Synthetic peptide derived from Drosophila Neuropeptide F. Immunogen Sequence: CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF.
PurificationDesc :
Protein A + Protein G affinity chromatography
RecommendedStorageDesc :
Short term: Store at 4°C for up to 1 month. Long term: Store at -20°C. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Reconstitute in sterile water to 1 mg/ml.
IsotypeName :
IgG
Gene :
NPF / Neuropeptide F
StandardGeneSymbol :
NPF
gene family :
New
Reactivity :
Fruit fly
Usage :
ELISA (1:1000 - 1:5000)
ShortWebDescription :
Neuropeptide F antibody LS-C343389 is an unconjugated rabbit polyclonal antibody to fruit fly Neuropeptide F (NPF). Validated for ELISA.
Synonyms :
NPF
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
