This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
ASF1B Antibody LS-C334761
catalog :
LS-C334761
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
AntibodyID :
345120
AntibodyName :
LS-C334761
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
ASF1B Antibody LS-C334761
Specificity :
Human ASF1B
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
GPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTY
HGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL
ASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCT
PIKGLGLPGCIPGLLPENSMDCI
Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1).
HGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL
ASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCT
PIKGLGLPGCIPGLLPENSMDCI
Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
ASF1B
StandardGeneSymbol :
ASF1B
Reactivity :
Human
Usage :
WB (1:200 - 1:1000)
ShortWebDescription :
ASF1B antibody LS-C334761 is an unconjugated rabbit polyclonal antibody to human ASF1B. Validated for WB.
UsageText :
The predicted MW is 22kDa, while the observed MW by Western blot was 17kDa.
Synonyms :
ASF1B, CIA-II, HAsf1, HAsf1b, CCG1-interacting factor A-II, HCIA-II, Histone chaperone ASF1B
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
