This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
ACPP / PAP Antibody LS-C331779
catalog :
LS-C331779
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry
product information
AntibodyID :
342138
AntibodyName :
LS-C331779
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
ACPP / PAP Antibody LS-C331779
Specificity :
Human ACPP / PAP
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
LVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQH
YELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAM
TNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYL
PFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLS
GLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTK
LRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKR
ATQIPSYKKLIMYSAHDTTVSGLQMAL
Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human ACPP (NP_001090.2).
YELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAM
TNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYL
PFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLS
GLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTK
LRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKR
ATQIPSYKKLIMYSAHDTTVSGLQMAL
Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human ACPP (NP_001090.2).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
ACPP / PAP
StandardGeneSymbol :
ACPP
Reactivity :
Mouse, Rat, Human
Usage :
IHC (1:100 - 1:200), WB (1:500 - 1:2000)
ShortWebDescription :
PAP antibody LS-C331779 is an unconjugated rabbit polyclonal antibody to PAP (ACPP) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
UsageText :
The predicted MW is 40kDa/44kDa/48kDa, while the observed MW by Western blot was 54kDa.
Synonyms :
ACPP, ACP3, 5-NT, 5-nucleotidase, Acid phosphatase, prostate, ACP-3, Ecto-5-nucleotidase, PAP, Prostatic acid phosphatase, Thiamine monophosphatase, Prostatic acid phosphotase, TMPase
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
