This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
S100A8 / MRP8 Antibody LS-C331639
catalog :
LS-C331639
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
341998
AntibodyName :
LS-C331639
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
S100A8 / MRP8 Antibody LS-C331639
Specificity :
Human S100A8 / MRP8
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLE
TECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
GVAAHKKSHEESHKE
Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human S100A8 (NP_002955.2).
TECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
GVAAHKKSHEESHKE
Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human S100A8 (NP_002955.2).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
S100A8 / MRP8
StandardGeneSymbol :
S100A8
Reactivity :
Mouse, Human
Usage :
IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P, WB (1:500 - 1:2000)
ShortWebDescription :
MRP8 antibody LS-C331639 is an unconjugated rabbit polyclonal antibody to MRP8 (S100A8) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
UsageText :
The predicted MW is 10kDa, while the observed MW by Western blot was 11kDa.
Synonyms :
S100A8, 60B8AG, CFAG, CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, CGLA, L1Ag, NIF, p8, Protein S100-A8, MRP8, Urinary stone protein band A, CP-10, MA387, MRP-8
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
