This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
F9 / Factor IX Antibody LS-C331558
catalog :
LS-C331558
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry
product information
AntibodyID :
341917
AntibodyName :
LS-C331558
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
F9 / Factor IX Antibody LS-C331558
Specificity :
Human F9 / Factor IX
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
TVFLDHENANKILNRPKRYNSGKLEEFVQGNLERECMEE
KCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG
SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFC
KNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVS
QTSKLTRA
Recombinant fusion protein containing a sequence corresponding to amino acids 29-192 of human F9 (NP_000124.1).
KCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG
SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFC
KNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVS
QTSKLTRA
Recombinant fusion protein containing a sequence corresponding to amino acids 29-192 of human F9 (NP_000124.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
F9 / Factor IX
StandardGeneSymbol :
F9
gene family :
Protease
Subfamily :
Serine S1
Reactivity :
Mouse, Human
Usage :
IHC (1:50 - 1:200), WB (1:500 - 1:2000)
ShortWebDescription :
Factor IX antibody LS-C331558 is an unconjugated rabbit polyclonal antibody to Factor IX (F9) from human. It is reactive with human and mouse. Validated for IHC and WB.
UsageText :
The predicted MW is 47kDa/51kDa, while the observed MW by Western blot was 50kDa.
Synonyms :
F9, Christmas Disease, Coagulation factor IX, Factor IX Deficiency, FIX, HEMB, F9 p22, Factor 9, Factor IX, Factor IX F9, FIX F9, Haemophilia B, THPH8, Christmas factor, Hemophilia B, PTC, Serine protease
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
