This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
CCND1 / Cyclin D1 Antibody LS-C331409
catalog :
LS-C331409
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunoprecipitation
product information
AntibodyID :
341768
AntibodyName :
LS-C331409
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
CCND1 / Cyclin D1 Antibody LS-C331409
Specificity :
Human CCND1 / Cyclin D1
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
PSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIK
CDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEE
EEEVDLACTPTDVRDVDI
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human CCND1 (NP_444284.1).
CDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEE
EEEVDLACTPTDVRDVDI
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human CCND1 (NP_444284.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
CCND1 / Cyclin D1
StandardGeneSymbol :
CCND1
Reactivity :
Mouse, Rat, Human
Usage :
IHC (1:50 - 1:200), IP, WB (1:500 - 1:2000)
ShortWebDescription :
Cyclin D1 antibody LS-C331409 is an unconjugated rabbit polyclonal antibody to Cyclin D1 (CCND1) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
UsageText :
The predicted MW is 33kDa, while the observed MW by Western blot was 34kDa.
Synonyms :
CCND1, B-cell lymphoma 1 protein, BCL-1 oncogene, B-cell CLL/lymphoma 1, BCL-1, Cyclin D1, G1/S-specific cyclin-D1, U21B31, PRAD1, BCL1, D11S287E, PRAD1 oncogene
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
