This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
SOCS3 Antibody LS-C331102
catalog :
LS-C331102
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
AntibodyID :
341461
AntibodyName :
LS-C331102
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
SOCS3 Antibody LS-C331102
Specificity :
Human SOCS3
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
GSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPS
PPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLV
LSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIRE
FLDQYDAPL
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human SOCS3 (NP_003946.3).
PPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLV
LSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIRE
FLDQYDAPL
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human SOCS3 (NP_003946.3).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
SOCS3
StandardGeneSymbol :
SOCS3
Reactivity :
Mouse
Usage :
WB
ShortWebDescription :
SOCS3 antibody LS-C331102 is an unconjugated rabbit polyclonal antibody to mouse SOCS3. Validated for WB.
UsageText :
The predicted MW is 24kDa, while the observed MW by Western blot was 33kDa.
Synonyms :
SOCS3, Cish3, Cytokine-induced SH2 protein 3, CIS-3, CIS3, SSI-3, STAT-induced STAT inhibitor 3, SSI3, ATOD4, SOCS-3
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
