This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
HSP90AA1 / Hsp90 Alpha A1 Antibody LS-C330936
catalog :
LS-C330936
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, immunoprecipitation
product information
AntibodyID :
341291
AntibodyName :
LS-C330936
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
HSP90AA1 / Hsp90 Alpha A1 Antibody LS-C330936
Specificity :
Human HSP90AA1 / Hsp90
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
NYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASG
DEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVER
LRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGL
ELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVV
SNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGY
MAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILL
YETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTA
DDTSAAVTEEMPPLEGDDDTSRMEEVD
Recombinant fusion protein containing a sequence corresponding to amino acids 433-732 of human HSP90AA1 (NP_005339.3).
DEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVER
LRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGL
ELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVV
SNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGY
MAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILL
YETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTA
DDTSAAVTEEMPPLEGDDDTSRMEEVD
Recombinant fusion protein containing a sequence corresponding to amino acids 433-732 of human HSP90AA1 (NP_005339.3).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
HSP90AA1 / Hsp90 Alpha A1
StandardGeneSymbol :
HSP90AA1
Reactivity :
Mouse, Rat, Human, Monkey
Usage :
IF (1:20 - 1:50), IP (1:50 - 1:200), RnaIP (1:20 - 1:50), WB (1:500 - 1:2000)
ShortWebDescription :
Hsp90 Alpha A1 antibody LS-C330936 is an unconjugated rabbit polyclonal antibody to Hsp90 Alpha A1 (HSP90AA1) from human. It is reactive with human, mouse, rat and other species. Validated for IF, IP, RnaIP and WB.
UsageText :
The predicted MW is 84kDa/98kDa, while the observed MW by Western blot was 100kDa.
Synonyms :
HSP90AA1, EL52, HSP86, Hsp89, HSP89A, HSPC1, Heat shock 86 kDa, Hsp90, HSP90A, HSP90N, HSPCA, HSPCAL4, HSPN, LAP2, HSP 86, HSPCAL1
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
