This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
c-Met Antibody LS-C330774
catalog :
LS-C330774
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
AntibodyID :
341126
AntibodyName :
LS-C330774
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
c-Met Antibody LS-C330774
Specificity :
Human c-Met
ClonalityDesc :
Monoclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIF
LGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCS
SKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTC
QRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRL
KETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNF
IYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLE
CILTEKRKKRSTKKEVFNILQAAYVSKP
Recombinant fusion protein containing a sequence corresponding to amino acids 25-325 of human MET (NP_001120972.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
c-Met
StandardGeneSymbol :
MET
gene family :
Protein Kinase
Subfamily :
HGF Receptor/MET
Reactivity :
Human
Usage :
WB (1:500 - 1:2000)
ShortWebDescription :
C-Met antibody LS-C330774 is an unconjugated rabbit monoclonal antibody to human c-Met. Validated for WB.
UsageText :
The predicted MW is 85kDa/155kDa/157kDa, while the observed MW by Western blot was 155kDa.
Synonyms :
MET, AUTS9, C-Met, HGF/SF receptor, HGFR, Met kinase, Proto-oncogene c-Met, Scatter factor receptor, SF receptor, HGF receptor, RCCP2, Tyrosine-protein kinase Met
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.