This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
AMH / Anti-Mullerian Hormone Antibody (clone 5/6, Supernatant) LS-C188251
catalog :
LS-C188251
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
196154
AntibodyName :
LS-C188251
TargetSpecies :
Human
Host Species :
Mouse
Product Name :
AMH / Anti-Mullerian Hormone Antibody (clone 5/6, Supernatant) LS-C188251
Specificity :
Is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. Plays a role in testicular differentiation and in the regulation of ovarian follicle growth. Is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.
ClonalityDesc :
Monoclonal
CloneName :
5/6
AntibodyModification :
Supernatant Unconjugated
PresentationDesc :
0.1% Sodium Azide
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Pig (100%); Panda, Dog, Bovine (97%); Rat, Guinea pig (94%).
PurificationDesc :
Tissue culture supernatant
RecommendedStorageDesc :
Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Microcentrifugation recommended if solution contains precipitate.
IsotypeName :
IgG1
Gene :
AMH / Anti-Mullerian Hormone
StandardGeneSymbol :
AMH
gene family :
TGF beta
Reactivity :
Human
Usage :
IHC, IHC-P (1:20 - 1:40)
ShortWebDescription :
Anti-Mullerian Hormone antibody LS-C188251 is an unconjugated mouse monoclonal antibody to human Anti-Mullerian Hormone (AMH). Validated for IHC.
Synonyms :
AMH, Anti-Muellerian hormone, Anti-Mullerian hormone, Muellerian-inhibiting factor, Mullerian inhibiting factor, Mullerian inhibiting substance, MIS
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments