This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
TLR4 Antibody (aa161-192) LS-C187853
catalog :
LS-C187853
clonality :
polyclonal
host :
domestic goat
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
195756
AntibodyName :
LS-C187853
TargetSpecies :
Human
Host Species :
Goat
Product Name :
TLR4 Antibody (aa161-192) LS-C187853
Specificity :
Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa161-192
PresentationDesc :
PBS, 0.1% Sodium Azide, 0.1% BSA
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-Terminus of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Baboon, Monkey (97%); Hamster (87%); Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%); Panda, Cat, Pig (81%).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Microcentrifugation recommended if solution contains precipitate.
IsotypeName :
IgG
Gene :
TLR4
StandardGeneSymbol :
TLR4
gene family :
Toll-like Receptor
Reactivity :
Human
Usage :
IHC, IHC-P (1:100 - 1:300), WB (1:1000)
ShortWebDescription :
TLR4 antibody LS-C187853 is an unconjugated goat polyclonal antibody to human TLR4 (aa161-192). Validated for IHC and WB.
Synonyms :
TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments