This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IL21 Receptor Antibody (aa35-65) LS-C187850
catalog :
LS-C187850
clonality :
polyclonal
host :
domestic goat
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry - paraffin section
product information
AntibodyID :
195753
AntibodyName :
LS-C187850
TargetSpecies :
Human
Host Species :
Goat
Product Name :
IL21 Receptor Antibody (aa35-65) LS-C187850
Specificity :
Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa35-65
PresentationDesc :
PBS, 0.1% Sodium Azide, 0.1% BSA
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-Terminus of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%); Chimpanzee, Gibbon (97%).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Store undiluted. Avoid freeze-thaw cycles. Microcentrifugation recommended if solution contains precipitate.
IsotypeName :
IgG
Gene :
IL21 Receptor
StandardGeneSymbol :
IL21R
gene family :
Interleukin
Reactivity :
Human
Usage :
ELISA (1:50000), IHC-P (1:150)
ShortWebDescription :
IL21 Receptor antibody LS-C187850 is an unconjugated goat polyclonal antibody to human IL21 Receptor (aa35-65). Validated for ELISA and IHC.
Synonyms :
IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments