This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IL21 Antibody (aa40-68) LS-C187848
catalog :
LS-C187848
clonality :
polyclonal
host :
domestic goat
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
195751
AntibodyName :
LS-C187848
TargetSpecies :
Human
Host Species :
Goat
Product Name :
IL21 Antibody (aa40-68) LS-C187848
Specificity :
Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa40-68
PresentationDesc :
PBS, 0.1% Sodium Azide, 0.1% BSA
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-Terminus of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon, Monkey, Marmoset (97%); Sheep, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Cat, Pig (83%).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Do not use frost-free freezers. Store undiluted. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
IL21
StandardGeneSymbol :
IL21
gene family :
Interleukin
Reactivity :
Human
Usage :
ELISA (1:100000), IHC, IHC-P
ShortWebDescription :
IL21 antibody LS-C187848 is an unconjugated goat polyclonal antibody to human IL21 (aa40-68). Validated for ELISA and IHC.
Synonyms :
IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.