This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
MAPK3 / ERK1 Antibody (aa372-406) LS-C16368
catalog :
LS-C16368
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunoprecipitation
product information
AntibodyID :
17109
AntibodyName :
LS-C16368
TargetSpecies :
Rat
Host Species :
Rabbit
Product Name :
MAPK3 / ERK1 Antibody (aa372-406) LS-C16368
Specificity :
Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa372-406
PresentationDesc :
0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 0.1 mM EDTA.
ImmunogenType :
Synthetic peptide - KLH conjugated
ImmunogenDesc :
Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-Terminus 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
PurificationDesc :
Immunoaffinity purified
RecommendedStorageDesc :
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
MAPK3 / ERK1
StandardGeneSymbol :
MAPK3
gene family :
Protein Kinase
Subfamily :
MAPK
Reactivity :
Rabbit, Mouse, Rat, Hamster
Usage :
Func, IP, WB (0.1 - 2 µg/ml)
ShortWebDescription :
ERK1 antibody LS-C16368 is an unconjugated rabbit polyclonal antibody to ERK1 (MAPK3) (aa372-406) from rat. It is reactive with mouse, rat, hamster and other species. Validated for Func, IP and WB.
UsageText :
Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Synonyms :
MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, MAP kinase 3, p44-ERK1, ERK1, PRKM3
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments