This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
MAPK3 / ERK1 Antibody (aa336-367) LS-C16357
catalog :
LS-C16357
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunohistochemistry, immunoprecipitation
product information
AntibodyID :
17098
AntibodyName :
LS-C16357
TargetSpecies :
Rat
Host Species :
Rabbit
Product Name :
MAPK3 / ERK1 Antibody (aa336-367) LS-C16357
Specificity :
This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa336-367
PresentationDesc :
Liquid
ImmunogenType :
Synthetic peptide - KLH conjugated
ImmunogenDesc :
A 35 residue synthetic peptide, corresponding to aa 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
PurificationDesc :
Protein A purified
RecommendedStorageDesc :
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Gene :
MAPK3 / ERK1
StandardGeneSymbol :
MAPK3
gene family :
Protein Kinase
Subfamily :
MAPK
Reactivity :
Rabbit, Mouse, Rat, Hamster
Usage :
IHC (10 µg/ml), IP (12.5 µg/ml), WB
ShortWebDescription :
ERK1 antibody LS-C16357 is an unconjugated rabbit polyclonal antibody to ERK1 (MAPK3) (aa336-367) from rat. It is reactive with mouse, rat, hamster and other species. Validated for IHC, IP and WB.
UsageText :
Western Blot (Colorimetric): 1 ug/ml 1 ug/ml. Western Blot (ECL). Immunoprecipitation: 12.5 ug/ml. Immunohistochemistry: 10 ug/ml. Positive control: Mouse Brain Tissue Extract.
Synonyms :
MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, MAP kinase 3, p44-ERK1, ERK1, PRKM3
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.