This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
HMOX1 / HO-1 Antibody (aa1-30) LS-C15741
catalog :
LS-C15741
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunoprecipitation
product information
AntibodyID :
16482
AntibodyName :
LS-C15741
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
HMOX1 / HO-1 Antibody (aa1-30) LS-C15741
Specificity :
Identifies purified rat HO-1 protein and will detect an ~32kD protein, corresponding to the apparent molecular mass of heme-oxygenase-1 on SDS-PAGE immunoblot. Species cross-reactivity: human, mouse, rat, canine, monkey, rabbit and hamster. Does not detect heme-oxygenase-2.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa1-30
PresentationDesc :
PBS, 0.09% Sodium Azide, 50% Glycerol
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to aa1-30 of human HO-1 prepared as a four branched multiple antigen peptide. Percent identity by BLAST analysis: Human, Orangutan, Gibbon, Marmoset, Bat (100%); Monkey, Mouse (97%); Elephant (90%); Rat, Pig (87%).
PurificationDesc :
Antiserum
RecommendedStorageDesc :
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
HMOX1 / HO-1
StandardGeneSymbol :
HMOX1
Reactivity :
Bat, Human
Usage :
IP (1:100), WB (1:2500)
ShortWebDescription :
HO-1 antibody LS-C15741 is an unconjugated rabbit polyclonal antibody to HO-1 (HMOX1) (aa1-30) from human. It is reactive with human and bat. Validated for IP and WB.
UsageText :
Suitable for use in Western Blot and Immunoprecipitation. Western Blot (ECL): 1:1000. Immunoprecipitation: 1:100.
Synonyms :
HMOX1, BK286B10, HO-1, HSP32, Heat shock protein, 32-kD, Heme oxygenase (decycling) 1, Heme oxygenase 1, HO1
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
