This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
FTH1 / Ferritin Heavy Chain Antibody (Preservative Free) LS-C149208
catalog :
LS-C149208
clonality :
polyclonal
host :
domestic rabbit
conjugate :
biotin
reactivity :
human
product information
AntibodyID :
154582
AntibodyName :
LS-C149208
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
FTH1 / Ferritin Heavy Chain Antibody (Preservative Free) LS-C149208
Specificity :
The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat Ferritin has not yet been tested.
ClonalityDesc :
Polyclonal
AntibodyModification :
Preservative Free Unconjugated
PresentationDesc :
Lyophilized from PBS, No preservatives added
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
CRAKNKIAKETNNKKKEFEETAEKVRCNSLVNLYLQASY
TYLSLGFYFDR.
Synthetic peptide derived from human Ferritin. Immunogen Sequence:
TYLSLGFYFDR.
Synthetic peptide derived from human Ferritin. Immunogen Sequence:
PurificationDesc :
Protein A + Protein G affinity chromatography
RecommendedStorageDesc :
Short term: Store at 4°C for up to 1 month. Long term: Store at -20°C. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Sterile PBS
IsotypeName :
IgG
Gene :
FTH1 / Ferritin Heavy Chain
StandardGeneSymbol :
FTH1
Reactivity :
Human
Usage :
ELISA (1:20000)
ShortWebDescription :
Ferritin Heavy Chain antibody LS-C149208 is an unconjugated rabbit polyclonal antibody to human Ferritin Heavy Chain (FTH1). Validated for ELISA.
UsageText :
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Synonyms :
FTH1, Apoferritin, Ferritin H subunit, Ferritin heavy chain, Ferritin, heavy polypeptide 1, FHC, FTHL6, PIG15, PLIF, FTH
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments