This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
PTH / Parathyroid Hormone Antibody LS-C131233
catalog :
LS-C131233
clonality :
polyclonal
host :
domestic goat
conjugate :
nonconjugated
reactivity :
human, rat
application :
radioimmunoassay
product information
AntibodyID :
134853
AntibodyName :
LS-C131233
TargetSpecies :
Rat
Host Species :
Goat
Product Name :
PTH / Parathyroid Hormone Antibody LS-C131233
Specificity :
Recognizes rat Parathyroid Hormone (aa 1-34).
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
Lyophilized from PBS, pH 7.2
ImmunogenDesc :
Synthetic rat PTH aa (1-34) bTG- conjugated(AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF). Percent identity by BLAST analysis: Rat (100%); Hamster (97%); Mouse (90%); Horse (87%); Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Pig (84%); Elephant, Panda, Dog, Cat (81%).
PurificationDesc :
Antiserum
RecommendedStorageDesc :
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
ResuspensionLiquidDesc :
Reconstitute with distilled H2O.
Gene :
PTH / Parathyroid Hormone
StandardGeneSymbol :
PTH
gene family :
Hormone
Reactivity :
Rat
Usage :
RIA (1:2000)
ShortWebDescription :
Parathyroid Hormone antibody LS-C131233 is an unconjugated goat polyclonal antibody to rat Parathyroid Hormone (PTH). Validated for RIA.
UsageText :
Suitable for use in RIA. RIA: 1:2000.
Synonyms :
PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
