This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
PTH / Parathyroid Hormone Antibody (aa1-34) LS-C131225
catalog :
LS-C131225
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
product information
AntibodyID :
134845
AntibodyName :
LS-C131225
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
PTH / Parathyroid Hormone Antibody (aa1-34) LS-C131225
Specificity :
Recognizes human PTH (aa 15-25; 1-34; 1-38; 1-84; 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-10).
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa1-34
PresentationDesc :
Lyophilized. 137mM Mannitol
ImmunogenDesc :
Synthetic human PTH (aa 1-34), bTG- conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%).
PurificationDesc :
Antiserum
RecommendedStorageDesc :
Lyophilized and resuspended forms: store at -20°C. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Reconstitute with 100ul sterile ddH2O
Gene :
PTH / Parathyroid Hormone
StandardGeneSymbol :
PTH
gene family :
Hormone
Reactivity :
Human, Monkey
Usage :
ELISA (1:3000)
ShortWebDescription :
Parathyroid Hormone antibody LS-C131225 is an unconjugated rabbit polyclonal antibody to Parathyroid Hormone (PTH) (aa1-34) from human. It is reactive with human and monkey. Validated for ELISA.
UsageText :
Suitable for use in ELISA: 1:3000.
Synonyms :
PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
