This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
GLP2 Antibody LS-C129258
catalog :
LS-C129258
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
product information
AntibodyID :
132878
AntibodyName :
LS-C129258
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
GLP2 Antibody LS-C129258
Specificity :
Recognizes human Glucagon like Peptide-2.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
Lyophilized from PBS, pH 7.2
ImmunogenDesc :
Synthetic human GLP-2, KLH-conjugated (HADGSFSDEMNTILDNLAARDFINWLIQTKITD). Percent identity by BLAST analysis: Human, Gorilla, Marmoset (100%); Gibbon, Rat, Guinea pig (97%); Monkey, Mouse, Hamster (94%); Elephant, Horse (90%); Sheep, Panda, Dog, Bovine, Pig (87%); Opossum (81%).
PurificationDesc :
Antiserum
RecommendedStorageDesc :
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
ResuspensionLiquidDesc :
Reconstitute with distilled H2O.
Gene :
GLP2
Reactivity :
Human
Usage :
ELISA (1:3000)
ShortWebDescription :
GLP2 antibody LS-C129258 is an unconjugated rabbit polyclonal antibody to human GLP2. Validated for ELISA.
UsageText :
Suitable for use in ELISA: 1:3000.
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
