This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
PTH / Parathyroid Hormone Antibody (aa1-38, clone A1/64) LS-C122287
catalog :
LS-C122287
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
immunohistochemistry, radioimmunoassay, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
AntibodyID :
125745
AntibodyName :
LS-C122287
TargetSpecies :
Human
Host Species :
Mouse
Product Name :
PTH / Parathyroid Hormone Antibody (aa1-38, clone A1/64) LS-C122287
Specificity :
Human Parathyroid Hormone (aa 1-38)Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84;), PTHrP (aa 1-86).
ClonalityDesc :
Monoclonal
CloneName :
A1/64
AntibodyModification :
Unconjugated
AntigenModification :
aa1-38
PresentationDesc :
Lyophilized from in 50 mM Tris, pH 7.2, 0.1% sodium azide
ImmunogenDesc :
Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%).
PurificationDesc :
Protein G purified
RecommendedStorageDesc :
May be stored at 4°C for short-term only. For long-term storage and to avoid freeze-thaw cycles, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for up to 1 year at -20°C.
ResuspensionLiquidDesc :
Reconstitute with distilled H2O.
IsotypeName :
IgG1
Gene :
PTH / Parathyroid Hormone
StandardGeneSymbol :
PTH
gene family :
Hormone
Reactivity :
Human, Monkey
Usage :
ELISA (1 µg/ml), IHC, IHC-Fr, IHC-P, RIA
ShortWebDescription :
Parathyroid Hormone antibody LS-C122287 is an unconjugated mouse monoclonal antibody to Parathyroid Hormone (PTH) (aa1-38) from human. It is reactive with human and monkey. Validated for ELISA, IHC and RIA.
UsageText :
Suitable for use in ELISA: 1 ug/ml. RIA: 25 ng/ml. Immunohistochemistry: 2 ug/ml. Frozen, paraffin.
Synonyms :
PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments