This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
STAT3 Antibody (aa688-722) LS-C10382
catalog :
LS-C10382
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, immunoprecipitation
product information
AntibodyID :
11123
AntibodyName :
LS-C10382
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
STAT3 Antibody (aa688-722) LS-C10382
Specificity :
Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa688-722
PresentationDesc :
0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.
ImmunogenType :
Fusion protein
ImmunogenDesc :
Bacterially expressed GST fusion protein corresponding to human STAT3 (aa 688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%).
PurificationDesc :
Protein A purified
RecommendedStorageDesc :
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
STAT3
StandardGeneSymbol :
STAT3
Reactivity :
Mouse, Bovine, Rat, Hamster, Pig, Horse, Human, Monkey
Usage :
GS, ICC (10 µg/ml), IP, WB (2 - 4 µg/ml)
ShortWebDescription :
STAT3 antibody LS-C10382 is an unconjugated rabbit polyclonal antibody to STAT3 (aa688-722) from human. It is reactive with human, mouse, rat and other species. Validated for GS, ICC, IP and WB.
UsageText :
Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 ug/ml shows positive immunostaining for STAT 3 in A431 cells fixed with 95% ethanol, 5% acetic acid. Immunoprecipitation: 4 ug immunoprecipitates STAT 3 from 500 ug of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.
Synonyms :
STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.