product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ KLF2 Antibody (N-Terminus) LS-B5627
catalog :
LS-B5627
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
image
image 1 :

Anti-KLF2 antibody IHC of mouse lymphoid tissue. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
product information
AntibodyID :
140233
AntibodyName :
LS-B5627
TargetSpecies :
Mouse
Host Species :
Rabbit
Product Name :
IHC-plus™ KLF2 Antibody (N-Terminus) LS-B5627
Specificity :
Mouse KLF2
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
N-Terminus
PresentationDesc :
PBS, 0.09% sodium azide, 2% sucrose
ImmunogenDesc :
Percent identity by BLAST analysis: Mouse, Zebra finch, Chicken (100%); Marmoset, Rat, Opossum (92%); Human, Gibbon, Galago, Pig (85%); Xenopus (83%).
MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDED
LNNVLDFILSM.
Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region
MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDED
LNNVLDFILSM.
Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region
PurificationDesc :
Immunoaffinity purified
RecommendedStorageDesc :
Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
Gene :
KLF2
BlockingPeptide :
LS-E13235
StandardGeneSymbol :
KLF2
Reactivity :
Chicken, Mouse, Pig, Human
Usage :
IHC, IHC-P (5 µg/ml), WB (0.2 - 1 µg/ml)
ShortWebDescription :
KLF2 antibody LS-B5627 is an unconjugated rabbit polyclonal antibody to KLF2 (N-Terminus) from mouse. It is reactive with human, mouse, chicken and other species. Validated for IHC and WB. Cited in 2 publications.
UsageText :
Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody.
Synonyms :
KLF2, Krueppel-like factor 2, Kruppel-like factor LKLF, Kruppel-like factor 2 (lung), Lung krueppel-like factor, LKLF
SalesRegion :
Worldwide
more info or order :
company information

LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
related products
browse more products
- IHC-plus™ NKX2-3 Antibody (aa281-330) LS-B5628 | LS-B5628
- IHC-plus™ PTRF / CAVIN Antibody (aa177-226) LS-B5629 | LS-B5629
- IHC-plus™ TBR1 Antibody (aa51-100) LS-B5630 | LS-B5630
- IHC-plus™ TTF1 / Txn Termination Factor Antibody (aa51-100) LS-B5631
- IHC-plus™ DNMT / DNMT1 Antibody (aa151-200) LS-B5632 | LS-B5632
questions and comments
