This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ PGIS / PTGIS Antibody (aa299-329) LS-B1615
catalog :
LS-B1615
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, bovine
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
47121
AntibodyName :
LS-B1615
TargetSpecies :
Bovine
Host Species :
Rabbit
Product Name :
IHC-plus™ PGIS / PTGIS Antibody (aa299-329) LS-B1615
Specificity :
Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa299-329
PresentationDesc :
TBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, 0.5% BSA
ImmunogenDesc :
Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Percent identity by BLAST analysis: Bovine (100%); Horse, Pig (87%); Gibbon, Monkey, Bat (83%); Human (80%).
PurificationDesc :
Immunoaffinity purified
RecommendedStorageDesc :
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
PGIS / PTGIS
StandardGeneSymbol :
PTGIS
Reactivity :
Bovine, Human
Usage :
IHC, IHC-P (5 µg/ml), WB
ShortWebDescription :
PTGIS antibody LS-B1615 is an unconjugated rabbit polyclonal antibody to PTGIS (PGIS) (aa299-329) from bovine. It is reactive with human and bovine. Validated for IHC and WB.
UsageText :
Immunohistochemistry: LS-B1615 was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for LS-B1615 was determined to be 5 ug/ml.
Synonyms :
PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments