product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ ABAT Antibody LS-B14889
catalog :
LS-B14889
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
citations: 1
Reference
Shen J, Wang C, Ying J, Xu T, McAlinden A, O Keefe R. Inhibition of 4-aminobutyrate aminotransferase protects against injury-induced osteoarthritis in mice. JCI Insight. 2019;4: pubmed publisher
product information
AntibodyID :
673978
AntibodyName :
LS-B14889
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IHC-plus™ ABAT Antibody LS-B14889
Specificity :
Human ABAT
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
SQAAAKVDVEFDYDGPLMKTEVPGPRSQELMKQLNIIQN
AEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIG
YSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQ
SLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKER
GQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMG
CLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKEN
QQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
Recombinant fusion protein containing a sequence corresponding to amino acids 29-300 of human ABAT (NP_001120920.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
ABAT
StandardGeneSymbol :
ABAT
Reactivity :
Mouse, Rat, Human
Usage :
IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
ShortWebDescription :
ABAT antibody LS-B14889 is an unconjugated rabbit polyclonal antibody to ABAT from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues. Cited in 1 publication.
UsageText :
The predicted MW is 56kDa, while the observed MW by Western blot was 49kDa.
Synonyms :
ABAT, 4-aminobutyrate transaminase, GABA aminotransferase, L-AIBAT, GABA transaminase, NPD009, GABA transferase, GABA-AT, GABA-T, GABAT
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.