product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ IL7 Antibody LS-B14351
catalog :
LS-B14351
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
image
image 1 :

Western blot analysis of extracts of various cell lines, using IL7 antibody.
image 2 :

Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
image 3 :

Immunofluorescence analysis of MCF-7 cells using IL7 antibody. Blue: DAPI for nuclear staining.
product information
AntibodyID :
503965
AntibodyName :
LS-B14351
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IHC-plus™ IL7 Antibody LS-B14351
Specificity :
Human IL7
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEF
NFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLH
LLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENK
SLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Recombinant fusion protein containing a sequence corresponding to amino acids 26-177 of human IL7 (NP_000871.1).
NFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLH
LLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENK
SLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Recombinant fusion protein containing a sequence corresponding to amino acids 26-177 of human IL7 (NP_000871.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
IL7
StandardGeneSymbol :
IL7
gene family :
IL-7/ IL-9
Reactivity :
Mouse, Rat, Human
Usage :
IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:100), WB (1:500 - 1:2000)
ShortWebDescription :
IL7 antibody LS-B14351 is an unconjugated rabbit polyclonal antibody to IL7 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues. Cited in 1 publication.
UsageText :
The predicted MW is 7kDa/15kDa/20kDa, while the observed MW by Western blot was 33kDa.
Synonyms :
IL7, IL-7, Interleukin-7, Interleukin 7
SalesRegion :
Worldwide
more info or order :
company information

LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
related products
browse more products
- IHC-plus™ CFHR3 / CFHL3 Antibody LS-B14352 | LS-B14352
- IHC-plus™ IL5 Antibody (aa43-92) LS-B14355 | LS-B14355
- IHC-plus™ EPHX4 / Epoxide Hydrolase 4 Antibody (Internal) LS-B14361 | LS-B14361
- IHC-plus™ TGFA / TGF Alpha Antibody LS-B14370 | LS-B14370
- PathPlus™ TFF3 / Trefoil Factor 3 Antibody LS-B14380 | LS-B14380
questions and comments
