This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ IL7R / CD127 Antibody LS-B14308
catalog :
LS-B14308
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
503920
AntibodyName :
LS-B14308
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IHC-plus™ IL7R / CD127 Antibody LS-B14308
Specificity :
Human IL7R / CD127
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAF
EDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKK
FLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSV
VYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDEN
KWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKG
FWSEWSPSYYFRTPEINNSSGEMD
Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human IL7R (NP_002176.2).
EDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKK
FLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSV
VYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDEN
KWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKG
FWSEWSPSYYFRTPEINNSSGEMD
Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human IL7R (NP_002176.2).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
IL7R / CD127
StandardGeneSymbol :
IL7R
gene family :
Interleukin
Reactivity :
Human
Usage :
IF (1:20 - 1:50), IHC (1:50 - 1:200), IHC-P (1:100), WB (1:500 - 1:2000)
ShortWebDescription :
CD127 antibody LS-B14308 is an unconjugated rabbit polyclonal antibody to human CD127 (IL7R). Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
UsageText :
The predicted MW is 28kDa/29kDa/34kDa/51kDa, while the observed MW by Western blot was 52kDa.
Synonyms :
IL7R, CD127, CD127 antigen, IL-7RA, IL-7 receptor subunit alpha, IL7RA, ILRA, Interleukin 7 receptor, CDW127, IL-7R subunit alpha, IL-7R-alpha
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
