This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ CNGA3 Antibody (aa1-165) LS-B13903
catalog :
LS-B13903
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
438223
AntibodyName :
LS-B13903
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IHC-plus™ CNGA3 Antibody (aa1-165) LS-B13903
Specificity :
Human CNGA3
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa1-165
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenDesc :
MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSS
EETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIF
LLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNA
QANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKK
DAIVVDPSS
Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1).
EETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIF
LLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNA
QANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKK
DAIVVDPSS
Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
CNGA3
StandardGeneSymbol :
CNGA3
gene family :
Ion Channel
Subfamily :
Cyclic nucleotide gated channel
Reactivity :
Mouse, Rat, Human
Usage :
IHC, IHC-P (1:100), WB
ShortWebDescription :
CNGA3 antibody LS-B13903 is an unconjugated rabbit polyclonal antibody to CNGA3 (aa1-165) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
UsageText :
The predicted MW is 76-79kDa, while the observed MW by Western blot was 110kDa.
Synonyms :
CNGA3, CCNCa, CCNCalpha, CCNC1, CNG channel alpha-3, CNG3, ACHM2, Achromatopsia 2, MCNG3, CNCG3, CNG-3
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
