This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ ANXA4 / Annexin IV Antibody LS-B12911
catalog :
LS-B12911
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
370220
AntibodyName :
LS-B12911
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IHC-plus™ ANXA4 / Annexin IV Antibody LS-B12911
Specificity :
Human ANXA4 / Annexin IV
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
IEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMF
QRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWG
TDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKS
ETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDD
NTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTS
GDYRKVLLVLCGGDD
Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human ANXA4 (NP_001144.1).
QRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWG
TDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKS
ETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDD
NTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTS
GDYRKVLLVLCGGDD
Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human ANXA4 (NP_001144.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
ANXA4 / Annexin IV
StandardGeneSymbol :
ANXA4
Reactivity :
Mouse, Rat, Human
Usage :
IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
ShortWebDescription :
Annexin IV antibody LS-B12911 is an unconjugated rabbit polyclonal antibody to Annexin IV (ANXA4) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
UsageText :
The predicted MW is 27kDa/35kDa, while the observed MW by Western blot was 35kDa.
Synonyms :
ANXA4, 35-beta calcimedin, ANX4, Annexin A4, Annexin IV, Annexin-4, Chromobindin-4, Endonexin I, Lipocortin IV, p32.5, PIG28, Proliferation-inducing gene 28, Protein II, ZAP36, p33/41, PAP-II, PP4-X
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
