This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IHC-plus™ CD86 Antibody LS-B11911
catalog :
LS-B11911
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
product information
AntibodyID :
353577
AntibodyName :
LS-B11911
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IHC-plus™ CD86 Antibody LS-B11911
Specificity :
Human CD86
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
AYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEV
YLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGL
YQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISN
ITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGI
MQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDK
TRLLSSPFSIELEDPQPPPDHIP
Recombinant fusion protein containing a sequence corresponding to amino acids 30-247 of human CD86 (NP_787058.4).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
CD86
StandardGeneSymbol :
CD86
Reactivity :
Human
Usage :
ICC (1:50 - 1:100), IF (1:50 - 1:100), IHC (1:50 - 1:200), IHC-P (1:100), IP (1:50 - 1:100), WB (1:500 - 1:2000)
ShortWebDescription :
CD86 antibody LS-B11911 is an unconjugated rabbit polyclonal antibody to human CD86. Validated for ICC, IF, IHC, IP and WB. Tested on 20 paraffin-embedded human tissues.
UsageText :
The predicted MW is 12kDa/24kDa/28kDa/31kDa/37kDa, while the observed MW by Western blot was 80kDa.
Synonyms :
CD86, Activation B7-2 antigen, B7-2, B7.2, B70, CD86 molecule, CTLA-4 counter-receptor B7.2, CD86 antigen, FUN-1, LAB72, BU63, CD28LG2, Ctla-4 counter-receptors b7.2
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.