This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CCDC90A Polyclonal Antibody
catalog :
PA5-95628
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CCDC90A Polyclonal Antibody
Catalog # :
PA5-95628
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Mcur1 encodes a protein that is a key regulator of mitochondrial calcium uniporter (MCU) required for calcium entry into mitochondrion. Mcur1 plays a direct role in uniporter-mediated calcium uptake via a direct interaction with MCU (mitochondrial calcium uniporter). Mcur1 may be involved in the assembly of the membrane components of the uniporter complex.
Immunogen :
A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
6230416A05Rik; AU015498; AV136929; AW554392; C6orf79; C88263; Ccdc90a; coiled-coil domain containing 90A; coiled-coil domain-containing protein 90A, mitochondrial; FMP32; formin-like protein 16; MCU regulator 1; MCUR1; MCURI1; Mitochondrial calcium uniporter regulator 1; RGD1307673
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments