This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
HECTD3 Polyclonal Antibody
catalog :
PA5-95622
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
HECTD3 Polyclonal Antibody
Catalog # :
PA5-95622
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
ELISA: 0.1-0.5 ug/mL, Flow Cytometry: Assay-dependent, Immunocytochemistry: Assay-dependent, Immunohistochemistry (Frozen): Assay-dependent, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.25-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
E3 ubiquitin ligases accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of TRIOBP and its subsequent proteasomal degradation, thus facilitating cell cycle progression by regulating the turn-over of TRIOBP. Mediates also ubiquitination of STX8.
Immunogen :
A synthetic peptide corresponding to a sequence of human HECTD3 (HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE).
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Flow Cytometry: Assay-dependent, Immunocytochemistry: Assay-dependent, Immunohistochemistry (Frozen): Assay-dependent, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.25-0.5 ug/mL
Aliases :
1700064K09Rik; AI467540; AW743312; E3 ubiquitin-protein ligase HECTD3; HECT domain containing 3; HECT domain containing E3 ubiquitin protein ligase 3; HECT domain E3 ubiquitin protein ligase 3; HECT domain-containing protein 3; HECTD3; HECT-type E3 ubiquitin transferase HECTD3; probable E3 ubiquitin-protein ligase HECTD3; RGD1309823
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA