This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
TMEM166 Polyclonal Antibody
catalog :
PA5-95621
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
TMEM166 Polyclonal Antibody
Catalog # :
PA5-95621
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: Assay-dependent, Immunocytochemistry: Assay-dependent, Immunohistochemistry (Frozen): Assay-dependent, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: Assay-dependent
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.
Immunogen :
A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA) (aa 1-34).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: Assay-dependent, Immunocytochemistry: Assay-dependent, Immunohistochemistry (Frozen): Assay-dependent, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: Assay-dependent
Aliases :
BC014699; eva-1 homolog A; eva-1 homolog A (C. elegans); eva-1 homolog A, regulator of programmed cell death; EVA1A; fam176a; family with sequence similarity 176, member A; protein eva-1 homolog A; Protein FAM176A; RGD1559797; SP24; tm166; tmem166; transmembrane protein 166; zgc:153298
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
