Sorcin Polyclonal Antibody | Invitrogen PA5-95611 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

Sorcin Polyclonal Antibody

catalog :

PA5-95611

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

citations: 1

Reference
Scieszka D, Hunter R, Begay J, Bitsui M, Lin Y, Galewsky J, et al. Neuroinflammatory and Neurometabolomic Consequences From Inhaled Wildfire Smoke-Derived Particulate Matter in the Western United States. Toxicol Sci. 2022;186:149-162 pubmed publisher

product information

Product Type :

Antibody

Product Name :

Sorcin Polyclonal Antibody

Catalog # :

PA5-95611

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Sorcin is a 198 amino acid, soluble, resistance-related, calcium-binding cytosolic protein belonging to the penta-EF hand (PEF) family of calcium binding proteins and contains 4 EF-hand calcium-binding motifs. Human Sorcin is known to share 95% sequence identity with hamster Sorcin. It is known to associate with the sarcolemmal proteins Annexin VII, cardiac ryanodine receptors and L-type Ca2+ channels and thus influence the intracellular Ca (2+)-homeostasis. It is also important in the regulation of intracellular Ca2+ cycling and Ca2+ influx pathways in the heart and skeletal muscle during excitation-contraction. It is overproduced in many multi-drug resistance (MDR) cells and regulates cell apoptosis pathways, thus acting as a new MDR marker for prognosis of acute myeloid leukemia (AML) and a good target for anti-MDR drug development.

Immunogen :

A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

22 kDa protein; 2210417O06Rik; 2900070H08Rik; calcium binding protein amplified in mutlidrug-resistant cells; CP22; CP-22; H_RG167B05.1; SCN; Sor; Sorcin; SRI; V19