SI Polyclonal Antibody | Invitrogen PA5-95609 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

SI Polyclonal Antibody

catalog :

PA5-95609

quantity :

100 ug

price :

US 454.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

SI Polyclonal Antibody

Catalog # :

PA5-95609

Quantity :

100 ug

Price :

US 454.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

Immunogen :

A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

2010204N08Rik; alpha-glucosidase; c-sis; fd42f04; fd44a09; Isomaltase; maltase-glucoamylase (alpha-glucosidase); maltase-glucoamylase, intestinal; mgam; oligosaccharide alpha-1,6-glucosidase; pdgf protein; PDGF subunit B; PDGF-2; Pdgfb; platelet derived growth factor, B polypeptide; platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); platelet-derived growth factor subunit B; Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); pro-sucrase-isomaltase (EC 3.2.1.48-10); SI; SIS; Si-s; SUCIMAL; Sucrase; sucrase isomaltase (alpha-glucosidase); sucrase isomaltase, structural; sucrase-isomaltase; sucrase-isomaltase (alpha-glucosidase); sucrase-isomaltase, intestinal; wu:fd42f04; wu:fd44a09