This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SI Polyclonal Antibody
catalog :
PA5-95609
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
SI Polyclonal Antibody
Catalog # :
PA5-95609
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Immunogen :
A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2010204N08Rik; alpha-glucosidase; c-sis; fd42f04; fd44a09; Isomaltase; maltase-glucoamylase (alpha-glucosidase); maltase-glucoamylase, intestinal; mgam; oligosaccharide alpha-1,6-glucosidase; pdgf protein; PDGF subunit B; PDGF-2; Pdgfb; platelet derived growth factor, B polypeptide; platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); platelet-derived growth factor subunit B; Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); pro-sucrase-isomaltase (EC 3.2.1.48-10); SI; SIS; Si-s; SUCIMAL; Sucrase; sucrase isomaltase (alpha-glucosidase); sucrase isomaltase, structural; sucrase-isomaltase; sucrase-isomaltase (alpha-glucosidase); sucrase-isomaltase, intestinal; wu:fd42f04; wu:fd44a09
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments