This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PMEL Polyclonal Antibody
catalog :
PA5-95605
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
PMEL Polyclonal Antibody
Catalog # :
PA5-95605
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Melanoma is a malignant tumor of melanocytes which are found predominantly in skin but also in the bowel and the eye (see uveal melanoma). It is one of the rarer types of skin cancer but causes the majority of skin cancer related deaths.
Immunogen :
A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
95 kDa melanocyte-specific secreted glycoprotein; 95kDa melanocyte-specific secreted glycoprotein; D10H12S53E; D12S53E; D12S53Eh; gp100; gp87; M-alpha; M-beta; ME20; ME20M; ME20-M; ME20-S; Melanocyte lineage specific antigen GP100; melanocyte protein mel 17; melanocyte protein PMEL; Melanocyte protein Pmel 17; melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; melanosomal matrix protein17; P1; P100; P26; PMEL; Pmel 17; PMEL17; premelanosome protein; Secreted melanoma-associated ME20 antigen; SI; SIL; SILV; silver homolog; silver locus protein; silver locus protein homolog; silver, mouse, homolog of
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA