CD229 Polyclonal Antibody | Invitrogen PA5-95601 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

CD229 Polyclonal Antibody

catalog :

PA5-95601

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

product information

Product Type :

Antibody

Product Name :

CD229 Polyclonal Antibody

Catalog # :

PA5-95601

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

CD229 (Ly9) is a cell surface receptor of the CD150 family, which includes also e.g. CD48 and CD224. Receptors of this family regulate cytokine production and cytotoxicity of lymphocytes and NK cells. High levels of CD229 are found on T and B cells, where its expression increases during their maturation. It is absent on granulocytes, bone marrow-derived dendritic cells, platelets and erythrocytes. CD229 has been also reported on mouse monocytes and NK cells. CD229 interacts homophilically through its N-terminal domain and localizes to the contact site between T cells and antigen presenting B cells during antigen-dependent immune synapse formation.

Immunogen :

A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL

Aliases :

AI893573; CD229; CDABP0070; Cell surface molecule Ly-9; hly9; Lgp100; LY9; Ly-9; Lymphocyte antigen 9; mLY9; RP11-312J18.1; Signaling lymphocytic activation molecule 3; SLAM family member 3; SLAMF3; T100; T-lymphocyte surface antigen Ly-9