HAS1 Polyclonal Antibody | Invitrogen PA5-95599 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

HAS1 Polyclonal Antibody

catalog :

PA5-95599

quantity :

100 ug

price :

US 454.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 1

Reference
Freise C, Biskup K, Blanchard V, Schnorr J, Taupitz M. Inorganic Phosphate-Induced Extracellular Vesicles from Vascular Smooth Muscle Cells Contain Elevated Levels of Hyaluronic Acid, Which Enhance Their Interaction with Very Small Superparamagnetic Iron Oxide Particles. Int J Mol Sci. 2024;25: pubmed publisher

product information

Product Type :

Antibody

Product Name :

HAS1 Polyclonal Antibody

Catalog # :

PA5-95599

Quantity :

100 ug

Price :

US 454.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Hyaluronic acid is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA is synthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extruded through pore-like structures into the extracellular space. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serum concentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. In addition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes, and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes.

Immunogen :

A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)

Format :

Lyophilized

Applications w/Dilutions :

Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

HA synthase 1; HAS; Has1; huHAS1; Hyaluronan synthase 1; hyaluronan synthase1; hyaluronate synthase 1; Hyaluronic acid synthase 1