This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
TANK Polyclonal Antibody
catalog :
PA5-95584
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
TANK Polyclonal Antibody
Catalog # :
PA5-95584
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
TANK was initially identified as a novel TRAF-interacting protein that regulated TRAF-mediated signal transduction. Specifically, ligand binding by surface receptors in the tumor necrosis factor (TNF) receptor and Toll/interleukin-1 (IL-1) receptor families lead to the formation of a TRAF/TANK complex that mediates the activation of the transcription factor NF-kappa-B. This activation of NF-kappa-B occurs through an association with the kinases IKK-iota and TBK1. More recently, it was shown that these proteins can then form a complex with NEMO, a protein that regulates the activity of the Ikappa-B complex. This suggests that in addition to the possibility that TBK1 and IKK-iota activate the IKKs, the association with the IKK complex may help these kinases modulate other functions, such as the transactivation potential of NF-kappa-B proteins. At least two isoforms of TANK are known to exist.
Immunogen :
A synthetic peptide corresponding to a sequence of human TANK (MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK) (aa 1-33).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
C86182; E430026L09Rik; ITRAF; I-TRAF; LOW QUALITY PROTEIN: TRAF family member-associated NF-kappa-B activator; OTTHUMP00000200694; OTTHUMP00000200695; OTTHUMP00000200696; OTTHUMP00000200698; OTTHUMP00000200700; OTTHUMP00000200703; OTTHUMP00000200704; TANK; TANK-like protein; TRAF family member associated NFKB activator; TRAF family member-associated Nf-kappa B activator; TRAF family member-associated NF-kappa-B activator; TRAF family member-associated NFKB activator; TRAF interacting protein TANK; TRAF2; TRAF-interacting protein; zgc:153048
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments