This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
RAD51 Polyclonal Antibody
catalog :
PA5-95579
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
RAD51 Polyclonal Antibody
Catalog # :
PA5-95579
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
RAD51 plays a critical role in homologous strand exchange, a key step in DNA repair through homologous recobination. It binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. RAD51 catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. It binds to a single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Mutations in the gene can results in breast cancer, mirror movements 2 and fanconi anemia.
Immunogen :
A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AV304093; BRCA1/BRCA2-containing complex, subunit 5; BRCC5; DNA repair protein RAD51; DNA repair protein RAD51 homolog 1; DNA repair protein RAD51 homolog A; DNA repair protein rhp51; FANCR; homolog to S.cerevisiae; HRAD51; HsRad51; HsT16930; MGC128559 protein; MRMV2; MUT5; rad51; RAD51 homolog; RAD51 homolog (RecA homolog); RAD51 homolog (RecA homolog, E. coli); RAD51 homolog A; RAD51 recombinase; RAD51 recombinase L homeolog; rad51.1; rad51.L; rad51-1; RAD51A; rad51-a; rad51-b; Reca; RecA family recombinase Rhp51; RecA, E. coli, homolog of; RecA-like protein; recombinase RAD51; recombination protein A; RGD1563603; rhp51; SPAC644.14c; wu:fb38e12; xrad51; XRad51.1; YER095W; zgc:77754
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA