MEF2C Polyclonal Antibody | Invitrogen PA5-95568 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

MEF2C Polyclonal Antibody

catalog :

PA5-95568

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

MEF2C Polyclonal Antibody

Catalog # :

PA5-95568

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.25-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

MEF2C is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.

Immunogen :

A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.25-0.5 ug/mL

Aliases :

5430401D19Rik; 9930028G15Rik; AV011172; C5DELq14.3; DEL5q14.3; hoo; hoover; id:ibd5026; MADS box transcription enhancer factor 2, polypeptide C; Mef2; mef2c; mef2c protein; mef2ca; Myocyte enhancer factor 2C; myocyte enhancer factor 2C MEF2C; myocyte enhancer factor 2ca; myocyte enhancer factor 2ca 4'-6'; myocyte enhancer factor 2ca delta gamma-like; myocyte enhancer factor 2ca variant 4; myocyte enhancer factor 2ca variant 5; myocyte enhancer factor 2ca variant 6; myocyte enhancer factor 2ca; myocyte-specific enhancer factor 2C; myocyte-specific enhancer factor 2C; RGD1563119; wu:fc05b06; zgc:64184; zgc:85726