This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
LRIG1 Polyclonal Antibody
catalog :
PA5-95565
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
LRIG1 Polyclonal Antibody
Catalog # :
PA5-95565
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
LRIG1 protein Q96JA1 is coded by a gene on a chromosome band 3p14.3, this region is known to be deleted in various human cancers. LRIG1 is considered to be a tumor suppressor gene in humans. LRIG1 is an integral cell-surface membrane protein that is expressed by specific cells in various human tissues and that its 143-kDa form might be cleaved into 111-kDa and 32-kDa fragments. The LRIG1 protein may inhibit the growth of tumors of glial cells and the down-regulation of the LRIG1 gene may be involved in the development and progression of the tumor.
Immunogen :
(AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKEL
YI).
A synthetic peptide corresponding to a sequence of mouse LRIG1
YI).
A synthetic peptide corresponding to a sequence of mouse LRIG1
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
D6Bwg0781e; DKFZp586O1624; Img; integral membrane glycoprotein; leucine rich repeats and immunoglobulin like domains 1; leucine-rich repeat protein LRIG1; leucine-rich repeats and immunoglobulin like domains 1; leucine-rich repeats and immunoglobulin-like domains 1; leucine-rich repeats and immunoglobulin-like domains protein 1; LIG1; LIG-1; LRIG1; ortholog of mouse integral membrane glycoprotein LIG-1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
