This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
NSE Polyclonal Antibody
catalog :
PA5-95555
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
NSE Polyclonal Antibody
Catalog # :
PA5-95555
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Neuron specific enolase (NSE, ENO1, ENO2, ENO3) is an enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway, and the reverse reaction in gluconeogenesis. NSE has a high stability in biological fluids and can easily diffuse to the extracellular medium and cerebrospinal fluid (CSF) when neuronal membranes are injured.NSE is one of three mammalian enolases, which are also known as ENO1, ENO2, and ENO3 or alternately as enolase alpha, beta and gamma. The alpha-subunit is expressed in most tissues, the beta-subunit only in muscle, and the gamma-subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. Co-expression of NSE and chromogranin A is common in neuroendocrine neoplasms. Since neurons require a great deal of energy, they are very rich in glycolytic enzymes such a GAPDH and NSE. Antibodies to NSE protein are useful to identify neuronal cell bodies, developing neuronal lineage and neuroendocrine cells. Release of NSE from damaged neurons into CSF and blood has also been used as a biomarker of neuronal injury. NSE is used clinically as a sensitive and useful marker of neuronal damage in several neurological disorders including stroke, hypoxic brain damage, status epilepticus, Creutzfeldt-Jakob disease, and herpetic encephalitis. Further, NSE is found in elevated concentrations in plasma and certain neoplasias that include pediatric neuroblastoma and small cell lung cancer.
Immunogen :
(LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGT
ENK).
A synthetic peptide corresponding to a sequence of human NSE
ENK).
A synthetic peptide corresponding to a sequence of human NSE
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2-phospho-D-glycerate hydrolyase; 2-phospho-D-glycerate hydro-lyase; AI837106; D6Ertd375e; Eno; ENO2; Eno-2; ENOG; Enolase 2; enolase 2 (gamma, neuronal); enolase 2, gamma neuronal; enolase 2, gamma, neuronal; epididymis secretory protein Li 279; gamma enolase; gamma-enolase; gamma-enolase-like; gamma-subunit of enolase; HEL-S-279; LOC100911625; Neural enolase; neuron specific enolase; neuron specific gamma enolase; Neuronal Enolase; neuronal enriched enolase; neurone-specific enolase; neuron-specific enolase; NSE; RNEN3
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments