This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ELAVL2 Polyclonal Antibody
catalog :
PA5-95553
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
ELAVL2 Polyclonal Antibody
Catalog # :
PA5-95553
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene.
Immunogen :
A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B); ELAV like 4; ELAV like neuron-specific RNA binding protein 2; Elav2; ELAVL 2; ELAVL 4; ELAVL2; ELAV-like neuronal protein 1; ELAV-like neuronal protein 1 isoform Hel-N2; ELAV-like protein 2; embryonic lethal, abnormal vision-like 2; HELN1; HEL-N1; Hu antigen B; Hu antigen D; hu-antigen B; HUB; HUD; mel-N1; Nervous system-specific RNA-binding protein Hel-N1; nervous system-specific RNA-binding protein Mel-N1; RNA binding protein HuB; zgc:91918
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA