This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Thrombospondin 2 Polyclonal Antibody
catalog :
PA5-95532
quantity :
100 ug
price :
US 474.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
Thrombospondin 2 Polyclonal Antibody
Catalog # :
PA5-95532
Quantity :
100 ug
Price :
US 474.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The Thrombospondin proteins (TSP 1-5) compose a family of glycoproteins that are involved in cell-to-cell and cell-to-matrix signaling. These extracellular, cell-surface proteins form complexes of both homo- and hetero-multimers. Thrombospondins play a role in development, aggregation of platelets, adhesion and migration of cells and progression of cells through the growth cycle. Thrombospondin 1 is released from platelets in response to Thrombin stimulation and is a transient component of the extracellular matrix of developing and repairing tissues. Thrombospondin 2 shares a high degree of homology with Thrombospondin 1, and is thought to have overlapping but unique functions. Thrombospondin 3 is a developmentally regulated heparin-binding protein. Thrombospondin 4 is neuronally expressed and stimulates neurite outgrowth.
Immunogen :
A synthetic peptide corresponding to a sequence of mouse Thrombospondin 2 (DHVKDTSFDLFSISNINRKTIGAKQFRGPD).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
Thbs2; Thbs-2; thrombospondin 2; Thrombospondin2; thrombospondin-2; TSP2; TSP-2; TSP2thrombospondin-2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
