This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Calcitonin Polyclonal Antibody
catalog :
PA5-95529
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
Calcitonin Polyclonal Antibody
Catalog # :
PA5-95529
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Calcitonin is a 32 amino acid peptide which can be demonstrated in C cells of the normal and hyperplastic thyroid. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
Immunogen :
A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP) (aa 85-116).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL
Aliases :
Alpha CGRP; Alpha type CGRP; Alpha-type CGRP; CA; Cal1; CAL6; CALC; CALC1; Calca; Calcitonin; calcitonin 1; Calcitonin carboxyl-terminal peptide; calcitonin gene related peptide 1; calcitonin gene related peptide I; calcitonin gene related peptide I precursor; Calcitonin gene-related peptide; calcitonin gene-related peptide 1; Calcitonin gene-related peptide I; calcitonin precursor; calcitonin related polypeptide alpha; calcitonin/calcitonin-related polypeptide, alpha; calcitonin; calcitonin gene-related peptide 1; calcitonin-like; calcitonin-related polypeptide alpha; CCALCI; CCP; Cgrp; CGRP1; CGRP-1; CGRPI; CGRP-I; CT; Ctn; katacalcin; katacalcin (KC); KC; PCT; PDN-21; prepro-alpha-calcitonin gene-related peptide; procalcitonin; RATCAL6
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA