RAB6A Polyclonal Antibody | Invitrogen PA5-95528 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

RAB6A Polyclonal Antibody

catalog :

PA5-95528

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

RAB6A Polyclonal Antibody

Catalog # :

PA5-95528

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Rab proteins are also an integral part of endocytic pathways. Rab 6A is a ubiquitously expressed member of the Rab family of proteins and localizes to the Golgi membrane where it regulates retrograde transport from the late endosomes via the Golgi to endoplasmic reticulum (ER) pathway. Three isoforms exist due to alternative splicing events, namely the ubiquitously expressed isoforms Rab 6A' and Rab 6A, and the brain-specific isoform Rab 6B.

Immunogen :

A synthetic peptide corresponding to a sequence of human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

2610028L11Rik; AA419671; MNCb-1660; Rab GTPase; Rab6; rab-6; RAB6, member RAS oncogene family; RAB6A; RAB6A, member RAS oncogene family; Rab6b; RAB6B, member RAS oncogene family; ras-related protein Rab-6A; RCO4-3