This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Fra1 Polyclonal Antibody
catalog :
PA5-95521
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
Product Type :
Antibody
Product Name :
Fra1 Polyclonal Antibody
Catalog # :
PA5-95521
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
The v-Fos oncogene was initially detected in two independent murine osteosarcoma virus isolates and an avian nephroblastoma virus. Members of the c-Fos gene family, including c-Fos, Fos B, Fra-1 and Fra-2, encode nuclear phosphoproteins that are rapidly and transiently induced by a variety of agents and function as transcriptional regulators for several genes. In contrast to c-Jun proteins, which form homo- and heterodimers that bind to specific DNA response elements, c-Fos proteins are only active as heterodimers with members of the Jun gene family. In addition, selected ATF/CREB family members can form leucine zipper dimers with Fos and Jun. Different dimers exhibit differential specificity and affinity for AP-1 and CRE sites.
Immunogen :
A synthetic peptide corresponding to a sequence of human FRA1 (QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
AW538199; FOS like 1, AP-1 trancription factor subunit; FOS like 1, AP-1 transcription factor subunit; FOS like antigen 1; Fosl1; FOS-like antigen 1; FOS-like antigen-1; fos-related antigen 1; FRA; Fra1; fra-1; HGNC:13718; LOW QUALITY PROTEIN: fos-related antigen 1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments