This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Factor V Polyclonal Antibody
catalog :
PA5-95520
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
Product Type :
Antibody
Product Name :
Factor V Polyclonal Antibody
Catalog # :
PA5-95520
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
Coagulation factor V (or Proaccelerin) is an essential factor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The active factor V is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in the Factor V gene can result various diseases including Factor V deficiency, thrombophilia due to activated protein C resistance, Budd-Chiari syndrome, Ischemic stroke, and recurrent pregnancy loss.
Immunogen :
A synthetic peptide corresponding to a sequence of human Factor V (ESTVMATRKMHDRLEPEDEESDADYDYQNRLAAALGIR).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
Ac2-120; Activated protein C cofactor; AI173222; Cf5; Cf-5; coagulation factor V; coagulation factor V (proaccelerin, labile factor); Coagulation factor V heavy chain; coagulation factor V jinjiang A2 domain; Coagulation factor V light chain; F5; Factor 5; factor V; factor V Leiden; Factor5; FVL; PCCF; Proaccelerin, labile factor; RPRGL1; THPH2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
