This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SFTPB Polyclonal Antibody
catalog :
PA5-95506
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
SFTPB Polyclonal Antibody
Catalog # :
PA5-95506
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Pulmonary surfactant is a complex mixture of phospholipids and proteins that is secreted from type II cells in alveoli and reduces the surface tension at the alveolar air-liquid interface, providing alveolar stability necessary for normal ventilation. Four distinct proteins isolated from pulmonary surfactant are termed surfactant proteins A, B, C, and D. SP-A (28-36kDa) and SP-D (43kDa) are collagenous carbohydrate-binding proteins, whereas SP-B (8-9kDa) and SP-C (4kDa) are non-collagenous hydrophobic proteins. SP-B is expressed in pulmonary adenocarcinomas with acinar, papillary, bronchioloalveolar, and solid growth patterns. Squamous cell and large cell carcinomas of the lung and nonpulmonary adenocarcinomas do not express SP-B. ProSP-B is glycosylated in the Golgi apparatus and undergoes carboxy- and amino-terminal proteolysis by a cathepsin D-like protease.
Immunogen :
A synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
18 kDa pulmonary-surfactant protein; 6 kDa protein; AI562151; P SFTB3; pot. surfactant-associated protein precursor; putative; preproprotein; PSP-B; Pulmonary surfactant protein 18; pulmonary surfactant protein B; pulmonary surfactant-associated protein B; pulmonary surfactant-associated protein B precursor; pulmonary surfactant-associated protein B; LOW QUALITY PROTEIN: pulmonary surfactant-associated protein B; Pulmonary surfactant-associated proteolipid SPL(Phe); SF-B; SFPB; SFTB3; SFTP3; Sftp-3; Sftpb; SMDP1; SP 18; SP-B; SPBS; surfactant associated protein B; surfactant protein B; surfactant protein-B; surfactant pulmonary-associated protein B; surfactant, pulmonary-associated protein B
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments