SFTPB Polyclonal Antibody | Invitrogen PA5-95506 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

SFTPB Polyclonal Antibody

catalog :

PA5-95506

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

Product Type :

Antibody

Product Name :

SFTPB Polyclonal Antibody

Catalog # :

PA5-95506

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Pulmonary surfactant is a complex mixture of phospholipids and proteins that is secreted from type II cells in alveoli and reduces the surface tension at the alveolar air-liquid interface, providing alveolar stability necessary for normal ventilation. Four distinct proteins isolated from pulmonary surfactant are termed surfactant proteins A, B, C, and D. SP-A (28-36kDa) and SP-D (43kDa) are collagenous carbohydrate-binding proteins, whereas SP-B (8-9kDa) and SP-C (4kDa) are non-collagenous hydrophobic proteins. SP-B is expressed in pulmonary adenocarcinomas with acinar, papillary, bronchioloalveolar, and solid growth patterns. Squamous cell and large cell carcinomas of the lung and nonpulmonary adenocarcinomas do not express SP-B. ProSP-B is glycosylated in the Golgi apparatus and undergoes carboxy- and amino-terminal proteolysis by a cathepsin D-like protease.

Immunogen :

A synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR).

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

18 kDa pulmonary-surfactant protein; 6 kDa protein; AI562151; P SFTB3; pot. surfactant-associated protein precursor; putative; preproprotein; PSP-B; Pulmonary surfactant protein 18; pulmonary surfactant protein B; pulmonary surfactant-associated protein B; pulmonary surfactant-associated protein B precursor; pulmonary surfactant-associated protein B; LOW QUALITY PROTEIN: pulmonary surfactant-associated protein B; Pulmonary surfactant-associated proteolipid SPL(Phe); SF-B; SFPB; SFTB3; SFTP3; Sftp-3; Sftpb; SMDP1; SP 18; SP-B; SPBS; surfactant associated protein B; surfactant protein B; surfactant protein-B; surfactant pulmonary-associated protein B; surfactant, pulmonary-associated protein B